HPA003733

THY1 antibody from Sigma-Aldrich
CD90
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003733
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003733, RRID:AB_1846340
Product name
Anti-THY1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003733
Antibody type
Polyclonal
Antigen
Thy-1 membrane glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTR
ETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYL
SAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDK
LVKCEGISLLAQNTSWL
Storage
-20C
Provider Type Product Number
- No reagents -