Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006732-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006732-M01, RRID:AB_607093
- Product name
- SRPK1 monoclonal antibody (M01), clone 6H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SRPK1.
- Antigen sequence
NETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDS
STSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQ
HISQLQESIRAEIPCEDEQEQEHNGPLDNK- Isotype
- IgG
- Antibody clone number
- 6H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SRPK1 monoclonal antibody (M01), clone 6H5 Western Blot analysis of SRPK1 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SRPK1 monoclonal antibody (M01), clone 6H5. Western Blot analysis of SRPK1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SRPK1 expression in transfected 293T cell line by SRPK1 monoclonal antibody (M01), clone 6H5.Lane 1: SRPK1 transfected lysate(74.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SRPK1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SRPK1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol