Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006732-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006732-A01, RRID:AB_462598
- Product name
- SRPK1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SRPK1.
- Antigen sequence
NETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDS
STSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQ
HISQLQESIRAEIPCEDEQEQEHNGPLDNK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-9 inhibition of cell proliferation and identification of novel miR-9 targets by transcriptome profiling in breast cancer cells.
Selcuklu SD, Donoghue MT, Rehmet K, de Souza Gomes M, Fort A, Kovvuru P, Muniyappa MK, Kerin MJ, Enright AJ, Spillane C
The Journal of biological chemistry 2012 Aug 24;287(35):29516-28
The Journal of biological chemistry 2012 Aug 24;287(35):29516-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SRPK1 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of SRPK1 expression in IMR-32 ( Cat # L008V1 ).