HPA016431

SRPK1 antibody from Sigma-Aldrich
SFRSK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016431
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016431, RRID:AB_1857478
Product name
Anti-SRPK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016431
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase SRPK1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEIEEMEKESGPGQKRPNKQEESESPVERPLKENP
PNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINC
NGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNL
NQESSFLSS
Storage
-20C
Provider Type Product Number
- No reagents -