Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000382 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000382, RRID:AB_1078908
- Product name
- Anti-FOXP2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPP
GQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMED
NGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Developmental Markers Expressed in Neocortical Layers Are Differentially Exhibited in Olfactory Cortex.
Prototypic and arkypallidal neurons in the dopamine-intact external globus pallidus.
Humanized Foxp2 specifically affects cortico-basal ganglia circuits.
A humanized version of Foxp2 affects cortico-basal ganglia circuits in mice.
Brunjes PC, Osterberg SK
PloS one 2015;10(9):e0138541
PloS one 2015;10(9):e0138541
Prototypic and arkypallidal neurons in the dopamine-intact external globus pallidus.
Abdi A, Mallet N, Mohamed FY, Sharott A, Dodson PD, Nakamura KC, Suri S, Avery SV, Larvin JT, Garas FN, Garas SN, Vinciati F, Morin S, Bezard E, Baufreton J, Magill PJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2015 Apr 29;35(17):6667-88
The Journal of neuroscience : the official journal of the Society for Neuroscience 2015 Apr 29;35(17):6667-88
Humanized Foxp2 specifically affects cortico-basal ganglia circuits.
Reimers-Kipping S, Hevers W, Pääbo S, Enard W
Neuroscience 2011 Feb 23;175:75-84
Neuroscience 2011 Feb 23;175:75-84
A humanized version of Foxp2 affects cortico-basal ganglia circuits in mice.
Enard W, Gehre S, Hammerschmidt K, Hölter SM, Blass T, Somel M, Brückner MK, Schreiweis C, Winter C, Sohr R, Becker L, Wiebe V, Nickel B, Giger T, Müller U, Groszer M, Adler T, Aguilar A, Bolle I, Calzada-Wack J, Dalke C, Ehrhardt N, Favor J, Fuchs H, Gailus-Durner V, Hans W, Hölzlwimmer G, Javaheri A, Kalaydjiev S, Kallnik M, Kling E, Kunder S, Mossbrugger I, Naton B, Racz I, Rathkolb B, Rozman J, Schrewe A, Busch DH, Graw J, Ivandic B, Klingenspor M, Klopstock T, Ollert M, Quintanilla-Martinez L, Schulz H, Wolf E, Wurst W, Zimmer A, Fisher SE, Morgenstern R, Arendt T, de Angelis MH, Fischer J, Schwarz J, Pääbo S
Cell 2009 May 29;137(5):961-71
Cell 2009 May 29;137(5):961-71
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate nuclear positivity in deep epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
- Sample type
- HUMAN
