HPA059339

ZDHHC12 antibody from Atlas Antibodies
FLJ14524, ZNF400
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA059339
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059339, RRID:AB_2683985
Product name
Anti-ZDHHC12
Provider product page
Atlas Antibodies - HPA059339
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRY
CLVLQPLRARHCRECRRCVRRY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -