H00002617-D01P

GARS1 antibody from Abnova Corporation
CMT2D, DSMAV, GARS, GlyRS, SMAD1

Antibody data

Product number
H00002617-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002617-D01P, RRID:AB_1573681
Product name
GARS purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00002617-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human GARS protein.
Antigen sequence
MDGAGAEEVLAPLRLAVRQQGDLVRKLKEDKAPQV
DVDKAVAELKARKRVLEAKELALQPKDDIVDRAKM
EDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKN
NIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGH
VDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDK
KCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVK
SPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPE
TAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEI
SPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVA
DLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNT
VLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAH
YACDCWDAESKTSYGWIEIVGCADRSCYDLSCHAR
ATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYK
KDAKLVMEYLAICDECYITEMEMLLNEKGEFTIET
EGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSF
GLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDD
SSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTA
TLRDRDSMRQIRAEISELPSIVQDLANGNITWADV
EARYPLFEGQETGKKETIEE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -