ABIN504529

GARS1 antibody from antibodies-online
CMT2D, DSMAV, GARS, GlyRS, SMAD1

Antibody data

Product number
ABIN504529
Provider
antibodies-online
Product name
anti-Glycyl-tRNA Synthetase (GARS) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504529
Antibody type
Polyclonal
Antigen
The immunogen for anti-GARS antibody: synthetic peptide directed towards the middle region of human GARS
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPA
VVAPF KCSVLPLSQN
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -