HPA019097

GARS1 antibody from Atlas Antibodies
CMT2D, DSMAV, GARS, GlyRS, SMAD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019097
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019097, RRID:AB_1849480
Product name
Anti-GARS
Provider product page
Atlas Antibodies - HPA019097
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGS
IGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRD
RDSMRQIRAEISELPSIVQDLANGNITWADVEARY
PLFEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -