PAB29361

DNAJA1 antibody from Abnova Corporation
dj-2, hdj-2, HSJ2, HSPF4, NEDD7

Antibody data

Product number
PAB29361
Provider
Abnova Corporation
Product name
DNAJA1 polyclonal antibody
Provider product page
Abnova Corporation - PAB29361
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human DNAJA1.
Antigen sequence
DQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPIS
TLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRR
PYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPE
RKEVEETDEMDQVELVDFDPNQERRRHYNGE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -