HPA001306

DNAJA1 antibody from Atlas Antibodies
dj-2, hdj-2, HSJ2, HSPF4, NEDD7
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001306
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001306, RRID:AB_611537
Product name
Anti-DNAJA1
Provider product page
Atlas Antibodies - HPA001306
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPIS
TLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRR
PYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPE
RKEVEETDEMDQVELVDFDPNQERRRHYNGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -