HPA001306

DNAJA1 antibody from Sigma-Aldrich
dj-2, hdj-2, HSJ2, HSPF4, NEDD7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001306
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001306, RRID:AB_1079043
Product name
Anti-DNAJA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001306
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily A member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPIS
TLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRR
PYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPE
RKEVEETDEMDQVELVDFDPNQERRRHYNGE
Storage
-20C
Provider Type Product Number
- No reagents -