Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001149-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001149-M01, RRID:AB_581667
- Product name
- CIDEA monoclonal antibody (M01), clone 4B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CIDEA.
- Antigen sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSP
RGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARP
FRVSNHDRSSRRGVMASSLQELISKTLDALVIATG
LVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQ
KWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDF
IGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRF
LSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQ
AKGRFTCG- Isotype
- IgG
- Antibody clone number
- 4B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Immunotherapeutic potential of anti-human endogenous retrovirus-K envelope protein antibodies in targeting breast tumors.
Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes.
Cidea is associated with lipid droplets and insulin sensitivity in humans.
Wang-Johanning F, Rycaj K, Plummer JB, Li M, Yin B, Frerich K, Garza JG, Shen J, Lin K, Yan P, Glynn SA, Dorsey TH, Hunt KK, Ambs S, Johanning GL
Journal of the National Cancer Institute 2012 Feb 8;104(3):189-210
Journal of the National Cancer Institute 2012 Feb 8;104(3):189-210
Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
Ito M, Nagasawa M, Omae N, Ide T, Akasaka Y, Murakami K
Journal of lipid research 2011 Aug;52(8):1450-60
Journal of lipid research 2011 Aug;52(8):1450-60
Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes.
Ito M, Nagasawa M, Hara T, Ide T, Murakami K
Journal of lipid research 2010 Jul;51(7):1676-84
Journal of lipid research 2010 Jul;51(7):1676-84
Cidea is associated with lipid droplets and insulin sensitivity in humans.
Puri V, Ranjit S, Konda S, Nicoloro SM, Straubhaar J, Chawla A, Chouinard M, Lin C, Burkart A, Corvera S, Perugini RA, Czech MP
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 3;105(22):7833-8
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 3;105(22):7833-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9.Lane 1: CIDEA transfected lysate(28.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol