Antibody data

Product number
H00001149-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001149-M01, RRID:AB_581667
Product name
CIDEA monoclonal antibody (M01), clone 4B9
Provider product page
Abnova Corporation - H00001149-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CIDEA.
Antigen sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSP
RGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARP
FRVSNHDRSSRRGVMASSLQELISKTLDALVIATG
LVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQ
KWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDF
IGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRF
LSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQ
AKGRFTCG
Isotype
IgG
Antibody clone number
4B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -