Antibody data

Product number
H00001149-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001149-D01, RRID:AB_10731088
Product name
CIDEA MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00001149-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CIDEA protein.
Antigen sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSP
RGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARP
FRVSNHDRSSRRGVMASSLQELISKTLDALVIATG
LVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQ
KWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDF
IGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRF
LSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQ
AKGRFTCG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -