H00057466-B01

SCAF4 antibody from Abnova Corporation
DKFZp434E098, KIAA1172, SFRS15, SRA4

Antibody data

Product number
H00057466-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057466-B01, RRID:AB_1204970
Product name
SFRS15 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057466-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SFRS15 protein.
Antigen sequence
MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIK
AIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIV
RQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSE
DKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGTSN
AAPVAENVTNNEGSPPPPVKVSSEPPTQATPNSVP
AVPQLPSSDAFAAVAQLFQTTQGQQLQQILQTFQQ
PPKPQSPALDNAVMAQVQAITAQLKTTPTQPSEQK
AAFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKE
DTTAVTTTAPAAAVPPAPTATVPAAAAPAAASPPP
PQAPFGFPGDGMQQPAYTQHQNMDQFQPRMMGIQQ
DPMHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIP
PTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPC
IQEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSR
RSRHRRSRSRSRDRRRHSPRSRSQERRDREKERER
RQKGLPQVKPETASVCSTTLWVGQLDKRTTQQDVA
SLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRAL
QKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDV
ELGVTYIPWDKVKPEELESFCEGGMLDSDTLNPDW
KGIPKKPENEVAQNGGAETSHTEPVSPIPKPLPVP
VPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAF
TPPLGIPPPGFGPGVPPPPPPPPFLRPGFNPMHLP
PGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAG
INEDTTKDLSIGNPIPTVVSGARGNAESGDSVKMY
GSAVPPAAPTNLPTPPVTQPVSLLGTQGVAPGPVI
GLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPL
MPPRPMPPHMMHRGPPPGPGGFAMPPPHGMKGPFP
PHGPFVRPGGMPGLGGPGPGPGGPEDRDGRQQPPQ
QPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQP
QQFRNDNRQQFNSGRDQERFGRRSFGNRVENDRER
YGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERN
RRSSGHRDRERDSRDRESRREKEEARGKEKPEVTD
RAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLK
PSEELPAEATSSVEPEKDSGSAAEAPR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -