HPA018319

SCAF4 antibody from Sigma-Aldrich
DKFZp434E098, KIAA1172, SFRS15, SRA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018319
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018319, RRID:AB_1856784
Product name
Anti-SFRS15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018319
Antibody type
Polyclonal
Antigen
Splicing factor, arginine/serine-rich 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPT
PPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQ
EVKRHMSDNRKSRSRSASRSPK
Storage
-20C
Provider Type Product Number
- No reagents -