HPA018668

SCAF4 antibody from MilliporeSigma / Merck KGaA
DKFZp434E098, KIAA1172, SFRS15, SRA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018668
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018668, RRID:AB_1856783
Product name
Anti-SFRS15 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018668
Antibody type
Polyclonal
Antigen
Splicing factor, arginine/serine-rich 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PITPPVSIPPPHTPPISIPNSTIAGINEDTTKDLS
IGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPT
NLPTPPVTQPVSLLGTQGVAPGPVIGLQAPSTGLL
GARPGLIPLQRPPGMP
Storage
-20C
Provider Type Product Number
- No reagents -