HPA028807

SCAF4 antibody from MilliporeSigma / Merck KGaA
DKFZp434E098, KIAA1172, SFRS15, SRA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028807
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028807, RRID:AB_10602927
Product name
Anti-SFRS15 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028807
Antibody type
Polyclonal
Antigen
splicing factor, arginine/serine-rich 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVKPEELESFCEGGMLDSDTLNPDWKGIPKKPENE
VAQNGGAETSHTEPVSPIPKPLPVPVPPIPVPAPI
TVPPPQVPPHQPGPPVVGALQP
Storage
-20C
Provider Type Product Number
- No reagents -