HPA018319

SCAF4 antibody from Atlas Antibodies
DKFZp434E098, KIAA1172, SFRS15, SRA4
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA018319
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018319, RRID:AB_1235561
Product name
Anti-SCAF4
Provider product page
Atlas Antibodies - HPA018319
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPT
PPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQ
EVKRHMSDNRKSRSRSASRSPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -