HPA018668

antibody from Atlas Antibodies

Targeting: SCAF4 DKFZp434E098, KIAA1172, SFRS15, SRA4

Antibody data

Submit

Validation data

Product number: HPA018668 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018668, RRID:AB_1856783
Product name: Anti-SCAF4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PITPPVSIPPPHTPPISIPNSTIAGINEDTTKDLS IGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPT NLPTPPVTQPVSLLGTQGVAPGPVIGLQAPSTGLL GARPGLIPLQRPPGMP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SCAF4 protein structure - HPA018668 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-SCAF4 antibody. Corresponding SCAF4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, skeletal muscle and testis using Anti-SCAF4 antibody HPA018668 (A) shows similar protein distribution across tissues to independent antibody HPA018319 (B).
Antibody #2 product nr: HPA021504, HPA018319, HPA028807
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SCAF4 antibody HPA018668.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SCAF4 antibody HPA018668.
Sample type: HUMAN