HPA001841

BRD8 antibody from Atlas Antibodies
p120, SMAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001841
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001841, RRID:AB_1845438
Product name
Anti-BRD8
Provider product page
Atlas Antibodies - HPA001841
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSL
KEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPK
EEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSH
TLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAI
MLVWRAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -