HPA001841

BRD8 antibody from Sigma-Aldrich
p120, SMAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001841
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001841, RRID:AB_1845438
Product name
Anti-BRD8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001841
Antibody type
Polyclonal
Antigen
Bromodomain-containing protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSL
KEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPK
EEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSH
TLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAI
MLVWRAA
Storage
-20C
Provider Type Product Number
- No reagents -