HPA019585

TVP23B antibody from Sigma-Aldrich
CGI-148, FAM18B, FAM18B1, YDR084C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019585, RRID:AB_1848385
Product name
Anti-FAM18B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019585
Antibody type
Polyclonal
Antigen
Protein FAM18B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Storage
-20C
Provider Type Product Number
- No reagents -