HPA001206

FAM71D antibody from Sigma-Aldrich
C14orf54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001206
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001206, RRID:AB_1848408
Product name
Anti-FAM71D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001206
Antibody type
Polyclonal
Antigen
Protein FAM71D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATEVTDSSDITNCSGVTVVFENNDLIRAKQEEKEK
LKNILKPGCLQDTKSKSELKESSKHVTISNITLTF
EGKRYFQTTLTPVESEANTSKEMKDKTSEEKMPDF
QSTALKAEESRSLRTESNTSVLSPHIKSPSNFLKL
VPHLSA
Storage
-20C
Provider Type Product Number
- No reagents -