HPA004739

FAM71D antibody from Sigma-Aldrich
C14orf54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004739, RRID:AB_1078332
Product name
Anti-FAM71D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004739
Antibody type
Polyclonal
Antigen
FAM71D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKKNTSKTTMRINKQDALCTPHSHDPRDLQNMLDG
GEYAPFVSPPMLESNFIQVNRRGESIYLHNRANWV
TVGICFSSSTHKIPNVMLLAHLTPGAQKDTETLFK
SLLTSPPAEKLVLTRFLPLQFVTLSVHDAENMSLK
VKLVSGRAYY
Storage
-20C
Provider Type Product Number
- No reagents -