HPA001309

OSBPL8 antibody from Sigma-Aldrich
MST120, MSTP120, ORP8, OSBP10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001309, RRID:AB_1079530
Product name
Anti-OSBPL8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001309
Antibody type
Polyclonal
Antigen
Oxysterol-binding protein-related protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQT
KVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPD
IQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIK
QTQEEIKRNIMALRNHLVSSTPATDY
Storage
-20C
Provider Type Product Number
- No reagents -