Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28411 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SUB1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SUB1.
- Antigen sequence
VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKT
GETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDF
KGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQ
LKEQI- Isotype
- IgG
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: A-431, lane 4: Liver and lane 5: Tonsil using SUB1 polyclonal antibody (Cat # PAB28411).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: NIH-3T3, lane 2: NBT-II and lane 3: PC12 cell lysates using SUB1 polyclonal antibody (Cat # PAB28411).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U-2 OS cell line with SUB1 polyclonal antibody (Cat # PAB28411) shows positivity in nucleus and nucleoli. Fixation/Permeabilization: PFA/Triton X-100
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human breast with SUB1 polyclonal antibody (Cat # PAB28411) shows strong nuclear positivity in glandular cells.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)