HPA001311

SUB1 antibody from Sigma-Aldrich
p14, p15, PC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001311, RRID:AB_1080123
Product name
Anti-SUB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001311
Antibody type
Polyclonal
Antigen
Activated RNA polymerase II transcriptional coactivator p15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKT
GETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDF
KGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQ
LKEQI
Storage
-20C
Provider Type Product Number
- No reagents -