HPA023940

FAM83G antibody from Sigma-Aldrich
FLJ41564, PAWS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023940
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023940, RRID:AB_1848416
Product name
Anti-FAM83G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023940
Antibody type
Polyclonal
Antigen
Protein FAM83G recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPR
YRSAADSVQSSTRNAGPAMAGPHHWQAKGGQ
Storage
-20C
Provider Type Product Number
- No reagents -