Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB28596 - Provider product page

 - Provider
 - Abnova Corporation
 - Product name
 - CNTNAP2 polyclonal antibody
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against recombinant CNTNAP2.
 - Antigen sequence
 CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDN
APDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSF
TTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHR
NMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SS- Isotype
 - IgG
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate); Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CNTNAP2 polyclonal antibody (Cat#PAB28596).
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescent staining of human cell line A-431 with CNTNAP2 polyclonal antibody (Cat#PAB28596) at 4 ug/ml shows positivity in centrosome.
 - Validation comment
 - Immunofluorescence
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human cerebral cortex with CNTNAP2 polyclonal antibody (Cat#PAB28596) shows strong cytoplasmic positivity in neuronal cells and distinct staining of neuropil at 1:200-1:500 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)