HPA002739

CNTNAP2 antibody from Atlas Antibodies
Caspr2, KIAA0868, NRXN4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002739
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002739, RRID:AB_1078545
Product name
Anti-CNTNAP2
Provider product page
Atlas Antibodies - HPA002739
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDN
APDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSF
TTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHR
NMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -