HPA002739

CNTNAP2 antibody from Sigma-Aldrich
Caspr2, KIAA0868, NRXN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002739, RRID:AB_1078545
Product name
Anti-CNTNAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002739
Antibody type
Polyclonal
Antigen
Contactin-associated protein-like 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDN
APDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSF
TTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHR
NMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SS
Storage
-20C
Provider Type Product Number
- No reagents -