HPA026609

RBMX2 antibody from Atlas Antibodies
CGI-79, Snu17
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026609
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026609, RRID:AB_1846601
Product name
Anti-RBMX2
Provider product page
Atlas Antibodies - HPA026609
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSES
SEDEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQ
PSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEP
REGQKLPKSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -