HPA026609

RBMX2 antibody from Sigma-Aldrich
CGI-79, Snu17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026609, RRID:AB_1846601
Product name
Anti-RBMX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026609
Antibody type
Polyclonal
Antigen
RNA-binding motif protein, X-linked 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSES
SEDEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQ
PSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEP
REGQKLPKSR
Storage
-20C
Provider Type Product Number
- No reagents -