HPA018519

RFX5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018519
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018519, RRID:AB_1856209
Product name
Anti-RFX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018519
Antibody type
Polyclonal
Antigen
DNA-binding protein RFX5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKG
SESPEMGPEVTPAPRDELVEAACALTCDWAERILK
RSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLA
EEDEHAPRERSSKPKNGLENPEGGAHKKPERLAQP
PKDLEART
Storage
-20C
Provider Type Product Number
- No reagents -