HPA018934

DENND6B antibody from Sigma-Aldrich
AFI1B, FAM116B, MGC33692
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018934
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018934, RRID:AB_1848365
Product name
Anti-FAM116B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018934
Antibody type
Polyclonal
Antigen
Protein FAM116B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGL
YTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALL
RRHLLELTQ
Storage
-20C
Provider Type Product Number
- No reagents -