HPA021653

DENND6B antibody from Sigma-Aldrich
AFI1B, FAM116B, MGC33692
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021653, RRID:AB_1848366
Product name
Anti-FAM116B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021653
Antibody type
Polyclonal
Antigen
Protein FAM116B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNLPVMGVVVQVRIPSRVDKSESSPPKQFDQENLL
PAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLG
EPLLVLAP
Storage
-20C
Provider Type Product Number
- No reagents -