HPA018934

DENND6B antibody from Atlas Antibodies
AFI1B, FAM116B, MGC33692
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018934
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018934, RRID:AB_1848365
Product name
Anti-DENND6B
Provider product page
Atlas Antibodies - HPA018934
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGL
YTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALL
RRHLLELTQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -