HPA020585

MIS18A antibody from Atlas Antibodies
B28, C21orf45, C21orf46, FASP1, hMis18alpha
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020585
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020585, RRID:AB_1845694
Product name
Anti-MIS18A
Provider product page
Atlas Antibodies - HPA020585
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRL
SEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE
EEAAAAEERPLVF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -