PAB21314

MIS18A antibody from Abnova Corporation
B28, C21orf45, C21orf46, FASP1, hMis18alpha

Antibody data

Product number
PAB21314
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21314, RRID:AB_10967824
Product name
C21orf45 polyclonal antibody
Provider product page
Abnova Corporation - PAB21314
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C21orf45.
Antigen sequence
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRL
SEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE
EEAAAAEERPLVF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -