HPA020585

MIS18A antibody from Sigma-Aldrich
B28, C21orf45, C21orf46, FASP1, hMis18alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020585, RRID:AB_1845694
Product name
Anti-C21orf45 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020585
Antibody type
Polyclonal
Antigen
Protein Mis18-alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRL
SEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE
EEAAAAEERPLVF
Storage
-20C
Provider Type Product Number
- No reagents -