HPA023118

RGS22 antibody from Sigma-Aldrich
CT145, DKFZP434I092, PRTD-NY2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023118
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023118, RRID:AB_1856244
Product name
Anti-RGS22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023118
Antibody type
Polyclonal
Antigen
Regulator of G-protein signaling 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDDVIEKGSKYMSESSKVIHLTSFTDISECLKPQL
DRRYAYTEEPRVKTVSDVGALGGSDMENLLQSLYV
ENRAGFFFTKFCEHSGNKLWKNSVYFWFDL
Storage
-20C
Provider Type Product Number
- No reagents -