HPA001356

MYO5A antibody from Sigma-Aldrich
GS1, MYH12, MYO5, MYR12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001356, RRID:AB_1079441
Product name
Anti-MYO5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001356
Antibody type
Polyclonal
Antigen
Myosin-Va recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEK
QDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQI
IDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNL
ILELKPRGVAVNLIPG
Storage
-20C
Provider Type Product Number
- No reagents -