Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005873-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005873-M02, RRID:AB_519010
- Product name
- RAB27A monoclonal antibody (M02), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB27A.
- Antigen sequence
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYG
IPYFETSAANGTNISQAIEMLLDLIMKRMERCVDK
SWIPEGVVRSNGHASTDQLSEEKEKGACGC- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PML-RARa modulates the vascular signature of extracellular vesicles released by acute promyelocytic leukemia cells.
Patients with Griscelli syndrome and normal pigmentation identify RAB27A mutations that selectively disrupt MUNC13-4 binding.
Exosome-mediated microRNA signaling from breast cancer cells is altered by the anti-angiogenesis agent docosahexaenoic acid (DHA).
Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect.
Activated Cdc42-bound IQGAP1 determines the cellular endocytic site.
Melanoma exosomes educate bone marrow progenitor cells toward a pro-metastatic phenotype through MET.
Stepwise maturation of lytic granules during differentiation and activation of human CD8+ T lymphocytes.
Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets.
The GDP-dependent Rab27a effector coronin 3 controls endocytosis of secretory membrane in insulin-secreting cell lines.
Fang Y, Garnier D, Lee TH, D'Asti E, Montermini L, Meehan B, Rak J
Angiogenesis 2016 Jan;19(1):25-38
Angiogenesis 2016 Jan;19(1):25-38
Patients with Griscelli syndrome and normal pigmentation identify RAB27A mutations that selectively disrupt MUNC13-4 binding.
Cetica V, Hackmann Y, Grieve S, Sieni E, Ciambotti B, Coniglio ML, Pende D, Gilmour K, Romagnoli P, Griffiths GM, Aricò M
The Journal of allergy and clinical immunology 2015 May;135(5):1310-8.e1
The Journal of allergy and clinical immunology 2015 May;135(5):1310-8.e1
Exosome-mediated microRNA signaling from breast cancer cells is altered by the anti-angiogenesis agent docosahexaenoic acid (DHA).
Hannafon BN, Carpenter KJ, Berry WL, Janknecht R, Dooley WC, Ding WQ
Molecular cancer 2015 Jul 16;14:133
Molecular cancer 2015 Jul 16;14:133
Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect.
Chen TC, Hsieh CH, Sarnow P
PLoS pathogens 2015 Aug;11(8):e1005116
PLoS pathogens 2015 Aug;11(8):e1005116
Activated Cdc42-bound IQGAP1 determines the cellular endocytic site.
Kimura T, Yamaoka M, Taniguchi S, Okamoto M, Takei M, Ando T, Iwamatsu A, Watanabe T, Kaibuchi K, Ishizaki T, Niki I
Molecular and cellular biology 2013 Dec;33(24):4834-43
Molecular and cellular biology 2013 Dec;33(24):4834-43
Melanoma exosomes educate bone marrow progenitor cells toward a pro-metastatic phenotype through MET.
Peinado H, Alečković M, Lavotshkin S, Matei I, Costa-Silva B, Moreno-Bueno G, Hergueta-Redondo M, Williams C, García-Santos G, Ghajar C, Nitadori-Hoshino A, Hoffman C, Badal K, Garcia BA, Callahan MK, Yuan J, Martins VR, Skog J, Kaplan RN, Brady MS, Wolchok JD, Chapman PB, Kang Y, Bromberg J, Lyden D
Nature medicine 2012 Jun;18(6):883-91
Nature medicine 2012 Jun;18(6):883-91
Stepwise maturation of lytic granules during differentiation and activation of human CD8+ T lymphocytes.
Sanchez-Ruiz Y, Valitutti S, Dupre L
PloS one 2011;6(11):e27057
PloS one 2011;6(11):e27057
Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets.
Neumüller O, Hoffmeister M, Babica J, Prelle C, Gegenbauer K, Smolenski AP
Blood 2009 Aug 13;114(7):1396-404
Blood 2009 Aug 13;114(7):1396-404
The GDP-dependent Rab27a effector coronin 3 controls endocytosis of secretory membrane in insulin-secreting cell lines.
Kimura T, Kaneko Y, Yamada S, Ishihara H, Senda T, Iwamatsu A, Niki I
Journal of cell science 2008 Sep 15;121(Pt 18):3092-8
Journal of cell science 2008 Sep 15;121(Pt 18):3092-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB27A monoclonal antibody (M02), clone 1G7 Western Blot analysis of RAB27A expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAB27A expression in transfected 293T cell line by RAB27A monoclonal antibody (M02), clone 1G7.Lane 1: RAB27A transfected lysate(24.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol