HPA001333

RAB27A antibody from Sigma-Aldrich
GS2, HsT18676, RAB27, RAM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001333
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001333, RRID:AB_1079730
Product name
Anti-RAB27A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001333
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-27A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNE
QSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLED
QRVVKEEEAIALAEKYGIPYFETSAANGTNISQAI
EMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQ
LS
Storage
-20C
Provider Type Product Number
- No reagents -