Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029206 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TEP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSDGILWNLAKCSPEGEWTTGNMWQKKANTPETQT
PGTDPSTCRESDASMDSDASMDSEPTPHLKTRQRR
KIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQ
LLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNV
YFLN- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway
Arabi A, Ullah K, Branca R, Johansson J, Bandarra D, Haneklaus M, Fu J, Ariës I, Nilsson P, Den Boer M, Pokrovskaja K, Grandér D, Xiao G, Rocha S, Lehtiö J, Sangfelt O
Nature Communications 2012;3(1)
Nature Communications 2012;3(1)
No comments: Submit comment
No validations: Submit validation data