HPA014347

MILR1 antibody from Atlas Antibodies
Allergin-1, C17orf60, MCA-32
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014347
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014347, RRID:AB_2732408
Product name
Anti-MILR1
Provider product page
Atlas Antibodies - HPA014347
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSM
FCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFN
LSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDP
VTSPVLNIMVIQTETDRHITLHCLSVNGSLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -