Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003217-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003217-M03, RRID:AB_581638
- Product name
- HOXB7 monoclonal antibody (M03), clone 4C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXB7.
- Antigen sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHC
APFEQNLSGVCPGDSAKAAGAKEQRDSDLAA- Isotype
- IgG
- Antibody clone number
- 4C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo.
A novel predictive equation for potential diagnosis of cholangiocarcinoma.
Li H, Shen LY, Yan WP, Dong B, Kang XZ, Dai L, Yang YB, Fu H, Yang HL, Zhou HT, Huang C, Liang Z, Xiong HC, Chen KN
PloS one 2015;10(6):e0130551
PloS one 2015;10(6):e0130551
A novel predictive equation for potential diagnosis of cholangiocarcinoma.
Kraiklang R, Pairojkul C, Khuntikeo N, Imtawil K, Wongkham S, Wongkham C
PloS one 2014;9(2):e89337
PloS one 2014;9(2):e89337
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol