HPA001429

NBN antibody from Atlas Antibodies
AT-V1, AT-V2, ATV, NBS, NBS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001429
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001429, RRID:AB_1854460
Product name
Anti-NBN
Provider product page
Atlas Antibodies - HPA001429
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAK
EISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSR
NPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGG
SDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLA
DDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -