HPA001429

NBN antibody from Sigma-Aldrich
AT-V1, AT-V2, ATV, NBS, NBS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001429
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001429, RRID:AB_1854460
Product name
Anti-NBN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001429
Antibody type
Polyclonal
Antigen
Nibrin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAK
EISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSR
NPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGG
SDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLA
DDL
Storage
-20C
Provider Type Product Number
- No reagents -